GLP
Encyclopedia
GLP can refer to:
- Gateway location protocol
- German Longhaired PointerGerman Longhaired PointerThe German longhaired pointer is a breed of dog. It was developed in Germany, and is used as a gundog.-Appearance:The GLP should be muscular, elegant, and athletic. It should not be bulky or cumbersome, and it should be able to move with great speed and freedom. It has moderate bone, but has...
- Gibraltar Labour PartyGibraltar Labour PartyThe Gibraltar Labour Party was a political party in Gibraltar. They described themselves as a progressive socialist organisation and stated that their formation was prompted by the need for a strong opposition to the government...
- Gibraltar Liberal PartyGibraltar Liberal PartyThe Gibraltar Liberal Party is a political party in Gibraltar. The party was founded in 1991 as Gibraltar National Party and is led by Dr...
- GleichmäßigkeitsprüfungGleichmäßigkeitsprüfungA Gleichmäßigkeitsprüfung is a motorsport event where precise timing is winning, not outright speed.Mainly Classic cars events like the modern Mille Miglia are held as GLPs....
, German for regularity test, a series for street-legal cars held at Nürburgring - Global Land ProjectGlobal Land ProjectThe Global Land Project is a research initiative of the International Geosphere-Biosphere Programme and the International Human Dimensions Programme . It aims to understand the changes of the land systems given the prospects of rapid and massive global environmental change...
- Glucagon-like peptide-1Glucagon-like peptide-1Glucagon-like peptide-1 is derived from the transcription product of the proglucagon gene. The major source of GLP-1 in the body is the intestinal L cell that secretes GLP-1 as a gut hormone. The biologically active forms of GLP-1 are: GLP-1- and GLP-1-NH2...
(GLP-1), a gut hormone involved in decreased feed intake and increased insulin secretion - Glucagon-like peptide-2Glucagon-like peptide-2Glucagon-like peptide-2 is a 33 amino acid peptide with the sequence HADGSFSDEMNTILDNLAARDFINWLIQTKITD in humans. GLP-2 is created by specific post-translational proteolytic cleavage of proglucagon in a process that also liberates the related glucagon-like peptide-1 . GLP-2 is produced by the...
(GLP-2), co-secreted with GLP-1, potentially linking intestinal growth and metabolism with nutrient intake - Glycerol facilitator protein
- Good Laboratory PracticeGood Laboratory PracticeIn the experimental research arena, the phrase good laboratory practice or GLP specifically refers to a quality system of management controls for research laboratories and organizations to try to ensure the uniformity, consistency, reliability, reproducibility, quality, and integrity of chemical ...
(See also GxPGxPGxP is a general term for Good Practice quality guidelines and regulations. These guidelines are used in many fields, including the pharmaceutical and food industries....
) - Green Liberal PartyGreen Liberal Party of SwitzerlandThe Green Liberal Party of Switzerland , abbreviated to glp, is a centrist Green liberal political party in Switzerland. Founded in 2007, the party holds five seats in the Federal Assembly....
, a Swiss political party. - GuadeloupeGuadeloupeGuadeloupe is an archipelago located in the Leeward Islands, in the Lesser Antilles, with a land area of 1,628 square kilometres and a population of 400,000. It is the first overseas region of France, consisting of a single overseas department. As with the other overseas departments, Guadeloupe...
(ISO 3166-1)