GLP
Encyclopedia
GLP can refer to:
  • Gateway location protocol
  • German Longhaired Pointer
    German Longhaired Pointer
    The German longhaired pointer is a breed of dog. It was developed in Germany, and is used as a gundog.-Appearance:The GLP should be muscular, elegant, and athletic. It should not be bulky or cumbersome, and it should be able to move with great speed and freedom. It has moderate bone, but has...

  • Gibraltar Labour Party
    Gibraltar Labour Party
    The Gibraltar Labour Party was a political party in Gibraltar. They described themselves as a progressive socialist organisation and stated that their formation was prompted by the need for a strong opposition to the government...

  • Gibraltar Liberal Party
    Gibraltar Liberal Party
    The Gibraltar Liberal Party is a political party in Gibraltar. The party was founded in 1991 as Gibraltar National Party and is led by Dr...

  • Gleichmäßigkeitsprüfung
    Gleichmäßigkeitsprüfung
    A Gleichmäßigkeitsprüfung is a motorsport event where precise timing is winning, not outright speed.Mainly Classic cars events like the modern Mille Miglia are held as GLPs....

    , German for regularity test, a series for street-legal cars held at Nürburgring
  • Global Land Project
    Global Land Project
    The Global Land Project is a research initiative of the International Geosphere-Biosphere Programme and the International Human Dimensions Programme . It aims to understand the changes of the land systems given the prospects of rapid and massive global environmental change...

  • Glucagon-like peptide-1
    Glucagon-like peptide-1
    Glucagon-like peptide-1 is derived from the transcription product of the proglucagon gene. The major source of GLP-1 in the body is the intestinal L cell that secretes GLP-1 as a gut hormone. The biologically active forms of GLP-1 are: GLP-1- and GLP-1-NH2...

     (GLP-1), a gut hormone involved in decreased feed intake and increased insulin secretion
  • Glucagon-like peptide-2
    Glucagon-like peptide-2
    Glucagon-like peptide-2 is a 33 amino acid peptide with the sequence HADGSFSDEMNTILDNLAARDFINWLIQTKITD in humans. GLP-2 is created by specific post-translational proteolytic cleavage of proglucagon in a process that also liberates the related glucagon-like peptide-1 . GLP-2 is produced by the...

     (GLP-2), co-secreted with GLP-1, potentially linking intestinal growth and metabolism with nutrient intake
  • Glycerol facilitator protein
  • Good Laboratory Practice
    Good Laboratory Practice
    In the experimental research arena, the phrase good laboratory practice or GLP specifically refers to a quality system of management controls for research laboratories and organizations to try to ensure the uniformity, consistency, reliability, reproducibility, quality, and integrity of chemical ...

     (See also GxP
    GxP
    GxP is a general term for Good Practice quality guidelines and regulations. These guidelines are used in many fields, including the pharmaceutical and food industries....

    )
  • Green Liberal Party
    Green Liberal Party of Switzerland
    The Green Liberal Party of Switzerland , abbreviated to glp, is a centrist Green liberal political party in Switzerland. Founded in 2007, the party holds five seats in the Federal Assembly....

    , a Swiss political party.
  • Guadeloupe
    Guadeloupe
    Guadeloupe is an archipelago located in the Leeward Islands, in the Lesser Antilles, with a land area of 1,628 square kilometres and a population of 400,000. It is the first overseas region of France, consisting of a single overseas department. As with the other overseas departments, Guadeloupe...

    (ISO 3166-1)
The source of this article is wikipedia, the free encyclopedia.  The text of this article is licensed under the GFDL.
 
x
OK